PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G021777_P01
Common NameZm.27242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 335aa    MW: 35391.5 Da    PI: 4.8134
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G021777_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.51.1e-072865438
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38
                       r C+ +  ++++l+C+ ++ +lC+ C    H g    H 
  GRMZM2G021777_P01 28 RPCDACAAEPARLHCRADGAFLCPGCDARAH-GagsrHA 65
                       68**************************999.4466675 PP

2zf-B_box22.91.7e-0767111341
           zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                         + C+ +e+ ++   C+ +   lC+ C   +H+       H++ p
  GRMZM2G021777_P01  67 VWLCEVCEHAPAAVTCRADAAALCAACDADIHSAnplarrHERLP 111
                        679*****************************6688888898877 PP

3CCT68.81.4e-23257300144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k+ 
  GRMZM2G021777_P01 257 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKRR 300
                        9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.2E-52569IPR000315B-box-type zinc finger
PROSITE profilePS501199.6842569IPR000315B-box-type zinc finger
PfamPF006438.3E-62865IPR000315B-box-type zinc finger
CDDcd000217.59E-72869No hitNo description
PROSITE profilePS5011910.42465112IPR000315B-box-type zinc finger
PfamPF006438.0E-667112IPR000315B-box-type zinc finger
SMARTSM003364.6E-970112IPR000315B-box-type zinc finger
PfamPF062031.3E-17257299IPR010402CCT domain
PROSITE profilePS5101716.916257299IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDTAAELELG LELEQKPAAG YWSVVGARPC DACAAEPARL HCRADGAFLC PGCDARAHGA  60
GSRHARVWLC EVCEHAPAAV TCRADAAALC AACDADIHSA NPLARRHERL PVAPLFGALA  120
DAPQPFPSPA FAAAAGAEAP AQGEAVAEDY GSSEAEAASW LLPEPDNSHE DSAADTFFAE  180
SDAYLGADLD FARCMDGVKA IGVPVAPPEL DIGAGSFCYP EHSMNHILSS SSEVAVVPDA  240
QAAGLPVVVV VSRGEEREAR LMRYREKRKN RRFDKTIRYA SRKAYAETRP RIKGRFAKRR  300
SAEGEDEALE HEEGACFSPT GSAPAASDGV VPSFC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.272420.0endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G021777
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G021777_P01
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9562390.0EU956239.1 Zea mays clone 1559496 CONSTANS-like protein CO5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147679.10.0CONSTANS-like protein CO5
TrEMBLA0A096Q3T00.0A0A096Q3T0_MAIZE; Uncharacterized protein
STRINGGRMZM2G021777_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-39CONSTANS-like 3